![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Sucrose phosphorylase [101920] (1 species) single beta-sheet; probable result of a decay of the common-fold |
![]() | Species Bifidobacterium adolescentis [TaxId:1680] [101921] (3 PDB entries) |
![]() | Domain d1r7ab1: 1r7a B:435-504 [97194] Other proteins in same PDB: d1r7aa2, d1r7ab2 complexed with trs |
PDB Entry: 1r7a (more details), 1.77 Å
SCOP Domain Sequences for d1r7ab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r7ab1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd dlianppvva
Timeline for d1r7ab1: