Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.12: AT-rich DNA-binding protein p25, C-terminal domain [102174] (1 protein) |
Protein AT-rich DNA-binding protein p25, C-terminal domain [102175] (1 species) forms swapped dimer with C-terminal helices |
Species Thermus aquaticus [TaxId:271] [102176] (1 PDB entry) |
Domain d1r72g2: 1r72 G:78-203 [97188] Other proteins in same PDB: d1r72a1, d1r72b1, d1r72c1, d1r72d1, d1r72e1, d1r72f1, d1r72g1 CASP5 complexed with ca, mg, nad |
PDB Entry: 1r72 (more details), 2.9 Å
SCOP Domain Sequences for d1r72g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r72g2 c.2.1.12 (G:78-203) AT-rich DNA-binding protein p25, C-terminal domain {Thermus aquaticus} nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls failnp
Timeline for d1r72g2: