Lineage for d1r72c2 (1r72 C:78-205)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 388812Family c.2.1.12: AT-rich DNA-binding protein p25, C-terminal domain [102174] (1 protein)
  6. 388813Protein AT-rich DNA-binding protein p25, C-terminal domain [102175] (1 species)
    forms swapped dimer with C-terminal helices
  7. 388814Species Thermus aquaticus [TaxId:271] [102176] (1 PDB entry)
  8. 388817Domain d1r72c2: 1r72 C:78-205 [97180]
    Other proteins in same PDB: d1r72a1, d1r72b1, d1r72c1, d1r72d1, d1r72e1, d1r72f1, d1r72g1

Details for d1r72c2

PDB Entry: 1r72 (more details), 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus

SCOP Domain Sequences for d1r72c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r72c2 c.2.1.12 (C:78-205) AT-rich DNA-binding protein p25, C-terminal domain {Thermus aquaticus}
nrkwglcivgmgrlgsaladypgfgesfelrgffdvdpekvgrpvrggviehvdllpqrv
pgrieialltvpreaaqkaadllvaagikgilnfapvvlevpkevavenvdflagltrls
failnpkw

SCOP Domain Coordinates for d1r72c2:

Click to download the PDB-style file with coordinates for d1r72c2.
(The format of our PDB-style files is described here.)

Timeline for d1r72c2:

  • d1r72c2 is new in SCOP 1.67
  • d1r72c2 became obsolete in SCOP 1.69