Lineage for d1r72b1 (1r72 B:4-77)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 351617Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families) (S)
    contains a small beta-sheet (wing)
  5. 352111Family a.4.5.38: AT-rich DNA-binding protein p25, N-terminal domain [101007] (1 protein)
  6. 352112Protein AT-rich DNA-binding protein p25, N-terminal domain [101008] (1 species)
  7. 352113Species Thermus aquaticus [TaxId:271] [101009] (1 PDB entry)
  8. 352115Domain d1r72b1: 1r72 B:4-77 [97177]
    Other proteins in same PDB: d1r72a2, d1r72b2, d1r72c2, d1r72d2, d1r72e2, d1r72f2, d1r72g2

Details for d1r72b1

PDB Entry: 1r72 (more details), 2.9 Å

PDB Description: Crystal Structure of p25 from Thermus aquaticus

SCOP Domain Sequences for d1r72b1:

Sequence, based on SEQRES records: (download)

>d1r72b1 a.4.5.38 (B:4-77) AT-rich DNA-binding protein p25, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsygtrgvgyt
vpvlkrelrhilgl

Sequence, based on observed residues (ATOM records): (download)

>d1r72b1 a.4.5.38 (B:4-77) AT-rich DNA-binding protein p25, N-terminal domain {Thermus aquaticus}
peaaisrlitylrileeleaqgvhrtsseqlgelaqvtafqvrkdlsyfgsgytvpvlkr
elrhilgl

SCOP Domain Coordinates for d1r72b1:

Click to download the PDB-style file with coordinates for d1r72b1.
(The format of our PDB-style files is described here.)

Timeline for d1r72b1:

  • d1r72b1 is new in SCOP 1.67
  • d1r72b1 does not appear in SCOP 1.69