SCOPe 2.07: Domain d1r6xa1: 1r6x A:2-168

Lineage for d1r6xa1 (1r6x A:2-168)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
   contains extra structures; some similarity to the PK beta-barrel domain
   automatically mapped to Pfam PF14306

6. Protein ATP sulfurylase N-terminal domain [63802] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (8 PDB entries)

8. Domain d1r6xa1: 1r6x A:2-168 [97167]
   Other proteins in same PDB: d1r6xa2
   complexed with co, so4

Details for d1r6xa1

PDB Entry: 1r6x, 1.4 Å

PDB Description: The Crystal Structure of a Truncated Form of Yeast ATP Sulfurylase, Lacking the C-Terminal APS Kinase-like Domain, in complex with Sulfate

PDB Compounds: (A:) ATP:sulfate adenylyltransferase

SCOPe Domain Sequences for d1r6xa1:

Sequence; same for both SEQRES and ATOM records:

>d1r6xa1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1r6xa1:

• d1r6xa1 first appeared in SCOP 1.67
  
• d1r6xa1 appears in SCOPe 2.06
  
• d1r6xa1 appears in the current release, SCOPe 2.08