SCOPe 2.06: Domain d1r6ha1: 1r6h A:4-172

Lineage for d1r6ha1 (1r6h A:4-172)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (9 proteins)

6. Protein Protein tyrosine phosphatase type IVa [102418] (3 species)

7. Species Human (Homo sapiens), pr-3 [TaxId:9606] [102419] (4 PDB entries)
   Uniprot O75365 1-162 # 99% sequence identity

8. Domain d1r6ha1: 1r6h A:4-172 [97150]
   Other proteins in same PDB: d1r6ha2

Details for d1r6ha1

PDB Entry: 1r6h

PDB Description: solution structure of human prl-3

PDB Compounds: (A:) protein tyrosine phosphatase type IVA, member 3 isoform 1

SCOPe Domain Sequences for d1r6ha1:

Sequence; same for both SEQRES and ATOM records:

>d1r6ha1 c.45.1.1 (A:4-172) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-3 [TaxId: 9606]}
marmnrpapvevsykhmrflithnptnatlstfiedlkkygattvvrvcevtydktplek
dgitvvdwpfddgapppgkvvedwlslvkakfceapgscvavhcvaglgrapvlvalali
esgmkyedaiqfirqkrrgainskqltylekyrpkqrlrfkdphthktr

Timeline for d1r6ha1:

• d1r6ha1 first appeared in SCOP 1.67, called d1r6ha_
  
• d1r6ha1 was called d1r6ha_ in SCOPe 2.05
  
• d1r6ha1 appears in SCOPe 2.07
  
• d1r6ha1 appears in the current release, SCOPe 2.08