Class b: All beta proteins [48724] (149 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (27 families) |
Family b.18.1.20: Proprotein convertase P-domain [89249] (3 proteins) a truncated form of this fold lacking one of the N-terminal strands |
Protein Kexin, C-terminal domain [89250] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89251] (2 PDB entries) |
Domain d1r64a1: 1r64 A:461-601 [97140] Other proteins in same PDB: d1r64a2, d1r64b2 |
PDB Entry: 1r64 (more details), 2.2 Å
SCOP Domain Sequences for d1r64a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r64a1 b.18.1.20 (A:461-601) Kexin, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} nvnaqtwfylptlyvsqstnsteetlesvitisekslqdanfkriehvtvtvdidteirg tttvdlispagiisnlgvvrprdvssegfkdwtfmsvahwgengvgdwkikvkttenghr idfhswrlklfgesidsskte
Timeline for d1r64a1: