Lineage for d1r5zc_ (1r5z C:)

  1. Root: SCOP 1.69
  2. 519077Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)
  3. 520731Fold f.40: V-type ATP synthase subunit C [103485] (1 superfamily)
    9 transmembrane helices
  4. 520732Superfamily f.40.1: V-type ATP synthase subunit C [103486] (1 family) (S)
    duplication: consists of three similar structural parts
  5. 520733Family f.40.1.1: V-type ATP synthase subunit C [103487] (1 protein)
  6. 520734Protein V-type ATP synthase subunit C [103488] (1 species)
  7. 520735Species Thermus thermophilus [TaxId:274] [103489] (2 PDB entries)
  8. 520739Domain d1r5zc_: 1r5z C: [97137]

Details for d1r5zc_

PDB Entry: 1r5z (more details), 1.95 Å

PDB Description: Crystal Structure of Subunit C of V-ATPase

SCOP Domain Sequences for d1r5zc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5zc_ f.40.1.1 (C:) V-type ATP synthase subunit C {Thermus thermophilus}
ddfaylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravl
rtqaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlree
vwrqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakaakg
ldqpalrdylalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyavld
elsgtpfsglsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrlrl
larrayfglpraqveeevvc

SCOP Domain Coordinates for d1r5zc_:

Click to download the PDB-style file with coordinates for d1r5zc_.
(The format of our PDB-style files is described here.)

Timeline for d1r5zc_: