SCOP 1.75: Domain d1r5wd1: 1r5w D:121-215

Lineage for d1r5wd1 (1r5w D:121-215)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries)
   probably orthologous to the human HLA-DR group

8. Domain d1r5wd1: 1r5w D:121-215 [97130]
   Other proteins in same PDB: d1r5wa1, d1r5wa2, d1r5wb2, d1r5wc1, d1r5wc2, d1r5wd2
   mutant

Details for d1r5wd1

PDB Entry: 1r5w, 2.9 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation

PDB Compounds: (D:) MHC H2-IE-beta

SCOP Domain Sequences for d1r5wd1:

Sequence; same for both SEQRES and ATOM records:

>d1r5wd1 b.1.1.2 (D:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]}
rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
tfqtlvmletvpqsgevytcqvehpsltdpvtvew

Timeline for d1r5wd1:

• d1r5wd1 first appeared in SCOP 1.67
  
• d1r5wd1 appears in SCOP 1.73
  
• d1r5wd1 appears in SCOPe 2.01
  
• d1r5wd1 appears in the current release, SCOPe 2.08