Lineage for d1r5wc2 (1r5w C:3-81)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406537Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1406652Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 1406672Domain d1r5wc2: 1r5w C:3-81 [97129]
    Other proteins in same PDB: d1r5wa1, d1r5wb1, d1r5wb2, d1r5wc1, d1r5wd1, d1r5wd2

Details for d1r5wc2

PDB Entry: 1r5w (more details), 2.9 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
PDB Compounds: (C:) H-2 class II histocompatibility antigen, E-K alpha chain

SCOPe Domain Sequences for d1r5wc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5wc2 d.19.1.1 (C:3-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
iavdkanldvmkersnntp

SCOPe Domain Coordinates for d1r5wc2:

Click to download the PDB-style file with coordinates for d1r5wc2.
(The format of our PDB-style files is described here.)

Timeline for d1r5wc2: