Lineage for d1r5vc2 (1r5v C:3-81)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 409342Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 409343Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 409344Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)
  6. 409588Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 409658Species Mouse (Mus musculus), I-EK [TaxId:10090] [88814] (9 PDB entries)
  8. 409672Domain d1r5vc2: 1r5v C:3-81 [97121]
    Other proteins in same PDB: d1r5va1, d1r5vb1, d1r5vb2, d1r5vc1, d1r5vd1, d1r5vd2

Details for d1r5vc2

PDB Entry: 1r5v (more details), 2.5 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation

SCOP Domain Sequences for d1r5vc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5vc2 d.19.1.1 (C:3-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-EK}
eehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgalan
iavdkanldvmkersnntp

SCOP Domain Coordinates for d1r5vc2:

Click to download the PDB-style file with coordinates for d1r5vc2.
(The format of our PDB-style files is described here.)

Timeline for d1r5vc2: