Lineage for d1r5vb2 (1r5v B:31-120)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 856282Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 856283Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 856284Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 856861Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 856965Species Mouse (Mus musculus), I-EK [TaxId:10090] [88827] (9 PDB entries)
  8. 856978Domain d1r5vb2: 1r5v B:31-120 [97119]
    Other proteins in same PDB: d1r5va1, d1r5va2, d1r5vb1, d1r5vc1, d1r5vc2, d1r5vd1

Details for d1r5vb2

PDB Entry: 1r5v (more details), 2.5 Å

PDB Description: evidence that structural rearrangements and/or flexibility during tcr binding can contribute to t-cell activation
PDB Compounds: (B:) MHC H2-IE-beta

SCOP Domain Sequences for d1r5vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5vb2 d.19.1.1 (B:31-120) Class II MHC beta chain, N-terminal domain {Mouse (Mus musculus), I-EK [TaxId: 10090]}
apwfleysksechfyngtqrvrllvryfynleenlrfdsdvgefravtelgrpdaenwns
qpefleqkraevdtvcrhnyeifdnflvpr

SCOP Domain Coordinates for d1r5vb2:

Click to download the PDB-style file with coordinates for d1r5vb2.
(The format of our PDB-style files is described here.)

Timeline for d1r5vb2: