Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Mouse (Mus musculus), I-E group [TaxId:10090] [88629] (9 PDB entries) probably orthologous to the human HLA-DR group |
Domain d1r5vb1: 1r5v B:121-215 [97118] Other proteins in same PDB: d1r5va1, d1r5va2, d1r5vb2, d1r5vc1, d1r5vc2, d1r5vd2 |
PDB Entry: 1r5v (more details), 2.5 Å
SCOPe Domain Sequences for d1r5vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r5vb1 b.1.1.2 (B:121-215) Class II MHC beta chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw tfqtlvmletvpqsgevytcqvehpsltdpvtvew
Timeline for d1r5vb1: