SCOP 1.71: Domain d1r5uj_: 1r5u J:

Lineage for d1r5uj_ (1r5u J:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.8: RNA polymerase [58180] (1 superfamily)

4. Superfamily i.8.1: RNA polymerase [58181] (1 family)

5. Family i.8.1.1: RNA polymerase [58182] (2 proteins)

6. Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (12 PDB entries)

8. Domain d1r5uj_: 1r5u J: [97112]

Details for d1r5uj_

PDB Entry: 1r5u, 4.5 Å

PDB Description: rna polymerase ii tfiib complex

SCOP Domain Sequences for d1r5uj_:

Sequence; same for both SEQRES and ATOM records:

>d1r5uj_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d1r5uj_:

• d1r5uj_ first appeared in SCOP 1.67
  
• d1r5uj_ appears in SCOP 1.69
  
• d1r5uj_ appears in SCOP 1.73
  
• d1r5uj_ appears in the current release, SCOPe 2.08