Lineage for d1r5ih_ (1r5i H:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1753091Fold a.202: Superantigen MAM [101343] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1753092Superfamily a.202.1: Superantigen MAM [101344] (1 family) (S)
    automatically mapped to Pfam PF09245
  5. 1753093Family a.202.1.1: Superantigen MAM [101345] (2 proteins)
  6. 1753094Protein Superantigen MAM [101346] (1 species)
  7. 1753095Species Mycoplasma arthritidis [TaxId:2111] [101347] (3 PDB entries)
  8. 1753099Domain d1r5ih_: 1r5i H: [97096]
    Other proteins in same PDB: d1r5ia1, d1r5ia2, d1r5ib1, d1r5ib2, d1r5ie1, d1r5ie2, d1r5if1, d1r5if2
    complexed with po4

Details for d1r5ih_

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex
PDB Compounds: (H:) Superantigen

SCOPe Domain Sequences for d1r5ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ih_ a.202.1.1 (H:) Superantigen MAM {Mycoplasma arthritidis [TaxId: 2111]}
smklrvenpkkaqkhfvqnlnnvvftnkelediynlsnkeetkevlklfklkvnqfyrha
fgivndynglleykeifnmmflklsvvfdtqrkeannveqikrniaildeimakadndls
yfisqnknfqelwdkavkltkemkiklkgqkldlrdgevainkvrelfgsdknvkelwwf
rsllvkgvylikryyegdielkttsdfakavfed

SCOPe Domain Coordinates for d1r5ih_:

Click to download the PDB-style file with coordinates for d1r5ih_.
(The format of our PDB-style files is described here.)

Timeline for d1r5ih_: