Lineage for d1r5if1 (1r5i F:93-190)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1107193Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 1107201Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (39 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 1107234Domain d1r5if1: 1r5i F:93-190 [97094]
    Other proteins in same PDB: d1r5ia1, d1r5ia2, d1r5ib2, d1r5id_, d1r5ie1, d1r5ie2, d1r5if2, d1r5ih_
    complexed with po4

Details for d1r5if1

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex
PDB Compounds: (F:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d1r5if1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5if1 b.1.1.2 (F:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d1r5if1:

Click to download the PDB-style file with coordinates for d1r5if1.
(The format of our PDB-style files is described here.)

Timeline for d1r5if1: