SCOPe 2.05: Domain d1r5ie2: 1r5i E:1-81

Lineage for d1r5ie2 (1r5i E:1-81)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)

7. Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)

8. Domain d1r5ie2: 1r5i E:1-81 [97093]
   Other proteins in same PDB: d1r5ia1, d1r5ib1, d1r5ib2, d1r5id_, d1r5ie1, d1r5if1, d1r5if2, d1r5ih_
   complexed with po4

Details for d1r5ie2

PDB Entry: 1r5i, 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex

PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1r5ie2:

Sequence; same for both SEQRES and ATOM records:

>d1r5ie2 d.19.1.1 (E:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

Timeline for d1r5ie2:

• d1r5ie2 first appeared in SCOP 1.67
  
• d1r5ie2 appears in SCOPe 2.04
  
• d1r5ie2 appears in SCOPe 2.06
  
• d1r5ie2 appears in the current release, SCOPe 2.08