SCOPe 2.04: Domain d1r5ie1: 1r5i E:82-181

Lineage for d1r5ie1 (1r5i E:82-181)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d1r5ie1: 1r5i E:82-181 [97092]
   Other proteins in same PDB: d1r5ia2, d1r5ib1, d1r5ib2, d1r5id_, d1r5ie2, d1r5if1, d1r5if2, d1r5ih_
   complexed with po4

Details for d1r5ie1

PDB Entry: 1r5i, 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex

PDB Compounds: (E:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1r5ie1:

Sequence; same for both SEQRES and ATOM records:

>d1r5ie1 b.1.1.2 (E:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1r5ie1:

• d1r5ie1 first appeared in SCOP 1.67
  
• d1r5ie1 appears in SCOPe 2.03
  
• d1r5ie1 appears in SCOPe 2.05
  
• d1r5ie1 appears in the current release, SCOPe 2.08