Lineage for d1r5ia2 (1r5i A:1-81)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2182597Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2183231Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2183270Species Human (Homo sapiens), HLA-DR2 [TaxId:9606] [88809] (13 PDB entries)
  8. 2183280Domain d1r5ia2: 1r5i A:1-81 [97088]
    Other proteins in same PDB: d1r5ia1, d1r5ib1, d1r5ib2, d1r5id1, d1r5id2, d1r5ie1, d1r5if1, d1r5if2, d1r5ih1, d1r5ih2
    complexed with po4

Details for d1r5ia2

PDB Entry: 1r5i (more details), 2.6 Å

PDB Description: Crystal structure of the MAM-MHC complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1r5ia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r5ia2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Human (Homo sapiens), HLA-DR2 [TaxId: 9606]}
ikeehviiqaefylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgal
aniavdkanleimtkrsnytp

SCOPe Domain Coordinates for d1r5ia2:

Click to download the PDB-style file with coordinates for d1r5ia2.
(The format of our PDB-style files is described here.)

Timeline for d1r5ia2: