Lineage for d1r4ni_ (1r4n I:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1402144Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1402145Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1402146Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1402240Protein Nedd8 [54244] (1 species)
  7. 1402241Species Human (Homo sapiens) [TaxId:9606] [54245] (10 PDB entries)
    Uniprot Q15843
  8. 1402265Domain d1r4ni_: 1r4n I: [97019]
    Other proteins in same PDB: d1r4na_, d1r4nb_, d1r4nc_, d1r4nd_, d1r4ne_, d1r4nf_, d1r4ng_, d1r4nh_
    complexed with APPBP1 and UBA3
    complexed with atp, zn

Details for d1r4ni_

PDB Entry: 1r4n (more details), 3.6 Å

PDB Description: appbp1-uba3-nedd8, an e1-ubiquitin-like protein complex with atp
PDB Compounds: (I:) Ubiquitin-like protein NEDD8

SCOPe Domain Sequences for d1r4ni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ni_ d.15.1.1 (I:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d1r4ni_:

Click to download the PDB-style file with coordinates for d1r4ni_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ni_: