Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (6 families) |
Family d.15.1.1: Ubiquitin-related [54237] (14 proteins) |
Protein Nedd8 [54244] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54245] (3 PDB entries) |
Domain d1r4ml_: 1r4m L: [97010] Other proteins in same PDB: d1r4ma_, d1r4mb_, d1r4mc_, d1r4md_, d1r4me_, d1r4mf_, d1r4mg_, d1r4mh_ complexed with APPBP1 and UBA3 complexed with zn; mutant |
PDB Entry: 1r4m (more details), 3 Å
SCOP Domain Sequences for d1r4ml_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ml_ d.15.1.1 (L:) Nedd8 {Human (Homo sapiens)} mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk ilggsvlhlvlalrgg
Timeline for d1r4ml_: