Lineage for d1r4ah_ (1r4a H:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018582Fold a.193: GRIP domain [101282] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 2018583Superfamily a.193.1: GRIP domain [101283] (1 family) (S)
  5. 2018584Family a.193.1.1: GRIP domain [101284] (1 protein)
  6. 2018585Protein Golgi autoantigen, golgin-245 [101285] (1 species)
  7. 2018586Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)
  8. 2018594Domain d1r4ah_: 1r4a H: [96993]
    Other proteins in same PDB: d1r4aa_, d1r4ab_, d1r4ac_, d1r4ad_
    complexed with gnp, mg

Details for d1r4ah_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
PDB Compounds: (H:) Golgi autoantigen, golgin subfamily A member 4

SCOPe Domain Sequences for d1r4ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ah_ a.193.1.1 (H:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]}
ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf

SCOPe Domain Coordinates for d1r4ah_:

Click to download the PDB-style file with coordinates for d1r4ah_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ah_: