Lineage for d1r4ag_ (1r4a G:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285372Fold a.193: GRIP domain [101282] (1 superfamily)
    6 helices, homodimer of 3-helical domains
  4. 1285373Superfamily a.193.1: GRIP domain [101283] (1 family) (S)
  5. 1285374Family a.193.1.1: GRIP domain [101284] (1 protein)
  6. 1285375Protein Golgi autoantigen, golgin-245 [101285] (1 species)
  7. 1285376Species Human (Homo sapiens) [TaxId:9606] [101286] (2 PDB entries)
  8. 1285383Domain d1r4ag_: 1r4a G: [96992]
    Other proteins in same PDB: d1r4aa_, d1r4ab_, d1r4ac_, d1r4ad_
    complexed with gnp, mg

Details for d1r4ag_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
PDB Compounds: (G:) Golgi autoantigen, golgin subfamily A member 4

SCOPe Domain Sequences for d1r4ag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ag_ a.193.1.1 (G:) Golgi autoantigen, golgin-245 {Human (Homo sapiens) [TaxId: 9606]}
ptefeylrkvlfeymmgretktmakvittvlkfpddqtqkileredarlmf

SCOPe Domain Coordinates for d1r4ag_:

Click to download the PDB-style file with coordinates for d1r4ag_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ag_: