Lineage for d1r4ad_ (1r4a D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1594391Protein ADP-ribosylation factor [52614] (16 species)
  7. 1594433Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (2 PDB entries)
  8. 1594441Domain d1r4ad_: 1r4a D: [96989]
    Other proteins in same PDB: d1r4ae_, d1r4af_, d1r4ag_, d1r4ah_
    complexed with gnp, mg

Details for d1r4ad_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX
PDB Compounds: (D:) ADP-ribosylation factor-like protein 1

SCOPe Domain Sequences for d1r4ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4ad_ c.37.1.8 (D:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr

SCOPe Domain Coordinates for d1r4ad_:

Click to download the PDB-style file with coordinates for d1r4ad_.
(The format of our PDB-style files is described here.)

Timeline for d1r4ad_: