| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein ADP-ribosylation factor [52614] (16 species) |
| Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (3 PDB entries) |
| Domain d1r4ac_: 1r4a C: [96988] Other proteins in same PDB: d1r4ae_, d1r4af_, d1r4ag_, d1r4ah_ complexed with gnp, mg |
PDB Entry: 1r4a (more details), 2.3 Å
SCOPe Domain Sequences for d1r4ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4ac_ c.37.1.8 (C:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}
remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
Timeline for d1r4ac_: