Lineage for d1r4aa_ (1r4a A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 581860Protein ADP-ribosylation factor [52614] (8 species)
  7. 581882Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (2 PDB entries)
  8. 581887Domain d1r4aa_: 1r4a A: [96986]
    Other proteins in same PDB: d1r4ae_, d1r4af_, d1r4ag_, d1r4ah_

Details for d1r4aa_

PDB Entry: 1r4a (more details), 2.3 Å

PDB Description: Crystal Structure of GTP-bound ADP-ribosylation Factor Like Protein 1 (Arl1) and GRIP Domain of Golgin245 COMPLEX

SCOP Domain Sequences for d1r4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r4aa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1}
remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir
pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt
psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr

SCOP Domain Coordinates for d1r4aa_:

Click to download the PDB-style file with coordinates for d1r4aa_.
(The format of our PDB-style files is described here.)

Timeline for d1r4aa_: