![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (45 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein ADP-ribosylation factor [52614] (8 species) |
![]() | Species Human (Homo sapiens), ARL1 [TaxId:9606] [102364] (2 PDB entries) |
![]() | Domain d1r4aa_: 1r4a A: [96986] Other proteins in same PDB: d1r4ae_, d1r4af_, d1r4ag_, d1r4ah_ |
PDB Entry: 1r4a (more details), 2.3 Å
SCOP Domain Sequences for d1r4aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r4aa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1} remrililgldgagkttilyrlqvgevvttiptigfnvetvtyknlkfqvwdlggqtsir pywrcyysntdaviyvvdscdrdrigiskselvamleeeelrkailvvfankqdmeqamt psemanalglpalkdrkwqifktsatkgtgldeamewlvetlksr
Timeline for d1r4aa_: