| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) ![]() |
| Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
| Protein Melibiase [75064] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102062] (2 PDB entries) alpha-galactosidase A |
| Domain d1r47a2: 1r47 A:32-323 [96978] Other proteins in same PDB: d1r47a1, d1r47b1 |
PDB Entry: 1r47 (more details), 3.45 Å
SCOP Domain Sequences for d1r47a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r47a2 c.1.8.1 (A:32-323) Melibiase {Human (Homo sapiens)}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp
Timeline for d1r47a2: