Lineage for d1r47a1 (1r47 A:324-421)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1555654Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1555976Protein Melibiase [75020] (4 species)
  7. 1555980Species Human (Homo sapiens) [TaxId:9606] [101919] (17 PDB entries)
    alpha-galactosidase A
  8. 1556013Domain d1r47a1: 1r47 A:324-421 [96977]
    Other proteins in same PDB: d1r47a2, d1r47b2
    complexed with edo, gal

Details for d1r47a1

PDB Entry: 1r47 (more details), 3.45 Å

PDB Description: structure of human alpha-galactosidase
PDB Compounds: (A:) Alpha-galactosidase A

SCOPe Domain Sequences for d1r47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r47a1 b.71.1.1 (A:324-421) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
lgkqgyqlrqgdnfevwerplsglawavaminrqeiggprsytiavaslgkgvacnpacf
itqllpvkrklgfyewtsrlrshinptgtvllqlentm

SCOPe Domain Coordinates for d1r47a1:

Click to download the PDB-style file with coordinates for d1r47a1.
(The format of our PDB-style files is described here.)

Timeline for d1r47a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r47a2