Lineage for d1r46b2 (1r46 B:32-323)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339680Protein Melibiase [75064] (4 species)
  7. 1339684Species Human (Homo sapiens) [TaxId:9606] [102062] (11 PDB entries)
    alpha-galactosidase A
  8. 1339704Domain d1r46b2: 1r46 B:32-323 [96976]
    Other proteins in same PDB: d1r46a1, d1r46b1
    complexed with edo, nag

Details for d1r46b2

PDB Entry: 1r46 (more details), 3.25 Å

PDB Description: structure of human alpha-galactosidase
PDB Compounds: (B:) Alpha-galactosidase A

SCOPe Domain Sequences for d1r46b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r46b2 c.1.8.1 (B:32-323) Melibiase {Human (Homo sapiens) [TaxId: 9606]}
ldnglartptmgwlhwerfmcnldcqeepdsciseklfmemaelmvsegwkdagyeylci
ddcwmapqrdsegrlqadpqrfphgirqlanyvhskglklgiyadvgnktcagfpgsfgy
ydidaqtfadwgvdllkfdgcycdslenladgykhmslalnrtgrsivyscewplymwpf
qkpnyteirqycnhwrnfadiddswksiksildwtsfnqerivdvagpggwndpdmlvig
nfglswnqqvtqmalwaimaaplfmsndlrhispqakallqdkdviainqdp

SCOPe Domain Coordinates for d1r46b2:

Click to download the PDB-style file with coordinates for d1r46b2.
(The format of our PDB-style files is described here.)

Timeline for d1r46b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r46b1