Lineage for d1r3nf2 (1r3n F:248-363)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2954343Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2954344Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2954370Protein Peptidase-like beta-alanine synthase [103003] (1 species)
  7. 2954371Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [103004] (2 PDB entries)
  8. 2954377Domain d1r3nf2: 1r3n F:248-363 [96956]
    Other proteins in same PDB: d1r3na1, d1r3nb1, d1r3nc1, d1r3nd1, d1r3ne1, d1r3nf1, d1r3ng1, d1r3nh1
    complexed with bib, zn

Details for d1r3nf2

PDB Entry: 1r3n (more details), 2.7 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri
PDB Compounds: (F:) beta-alanine synthase

SCOPe Domain Sequences for d1r3nf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3nf2 d.58.19.1 (F:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri) [TaxId: 4934]}
aynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpys
vniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvsp

SCOPe Domain Coordinates for d1r3nf2:

Click to download the PDB-style file with coordinates for d1r3nf2.
(The format of our PDB-style files is described here.)

Timeline for d1r3nf2: