Lineage for d1r3ne2 (1r3n E:248-363)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503917Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 505109Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 505110Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (5 proteins)
  6. 505126Protein Peptidase-like beta-alanine synthase [103003] (1 species)
  7. 505127Species Yeast (Saccharomyces kluyveri) [TaxId:4934] [103004] (2 PDB entries)
  8. 505132Domain d1r3ne2: 1r3n E:248-363 [96954]
    Other proteins in same PDB: d1r3na1, d1r3nb1, d1r3nc1, d1r3nd1, d1r3ne1, d1r3nf1, d1r3ng1, d1r3nh1

Details for d1r3ne2

PDB Entry: 1r3n (more details), 2.7 Å

PDB Description: Crystal structure of beta-alanine synthase from Saccharomyces kluyveri

SCOP Domain Sequences for d1r3ne2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3ne2 d.58.19.1 (E:248-363) Peptidase-like beta-alanine synthase {Yeast (Saccharomyces kluyveri)}
aynwqkvtvhgvgahagttpwrlrkdallmsskmivaaseiaqrhnglftcgiidakpys
vniipgevsftldfrhpsddvlatmlkeaaaefdrlikindggalsyesetlqvsp

SCOP Domain Coordinates for d1r3ne2:

Click to download the PDB-style file with coordinates for d1r3ne2.
(The format of our PDB-style files is described here.)

Timeline for d1r3ne2: