SCOPe 2.06: Domain d1r3lc_: 1r3l C:

Lineage for d1r3lc_ (1r3l C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d1r3lc_: 1r3l C: [96942]
   Other proteins in same PDB: d1r3la1, d1r3la2, d1r3lb1, d1r3lb2
   complexed with cs, dga, f09

Details for d1r3lc_

PDB Entry: 1r3l, 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+

PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1r3lc_:

Sequence; same for both SEQRES and ATOM records:

>d1r3lc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1r3lc_:

• d1r3lc_ first appeared in SCOP 1.67
  
• d1r3lc_ appears in SCOPe 2.05
  
• d1r3lc_ appears in SCOPe 2.07
  
• d1r3lc_ appears in the current release, SCOPe 2.08