Lineage for d1r3lc_ (1r3l C:)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2252668Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2252669Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
  5. 2252670Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2252691Protein Potassium channel protein [56901] (2 species)
  7. 2252692Species Streptomyces coelicolor [TaxId:1902] [56902] (22 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 2252700Domain d1r3lc_: 1r3l C: [96942]
    Other proteins in same PDB: d1r3la1, d1r3la2, d1r3lb1, d1r3lb2
    complexed with cs, dga, f09

Details for d1r3lc_

PDB Entry: 1r3l (more details), 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1r3lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3lc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d1r3lc_:

Click to download the PDB-style file with coordinates for d1r3lc_.
(The format of our PDB-style files is described here.)

Timeline for d1r3lc_: