SCOP 1.67: Domain d1r3lc_: 1r3l C:

Lineage for d1r3lc_ (1r3l C:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (4 proteins)

6. Protein Potassium channel protein [56901] (1 species)

7. Species Streptomyces lividans [TaxId:1916] [56902] (12 PDB entries)

8. Domain d1r3lc_: 1r3l C: [96942]
   Other proteins in same PDB: d1r3la1, d1r3la2, d1r3lb1, d1r3lb2
   complexed with cs, dga, f09; mutant

Details for d1r3lc_

PDB Entry: 1r3l, 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+

SCOP Domain Sequences for d1r3lc_:

Sequence; same for both SEQRES and ATOM records:

>d1r3lc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d1r3lc_:

• d1r3lc_ is new in SCOP 1.67
  
• d1r3lc_ appears in SCOP 1.69
  
• d1r3lc_ appears in the current release, SCOPe 2.08