SCOP 1.67: Domain d1r3lb2: 1r3l B:119-219

Lineage for d1r3lb2 (1r3l B:119-219)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)

8. Domain d1r3lb2: 1r3l B:119-219 [96941]
   Other proteins in same PDB: d1r3la1, d1r3la2, d1r3lb1, d1r3lc_
   part of Fab against potassium channel KcsA
   complexed with cs, dga, f09; mutant

Details for d1r3lb2

PDB Entry: 1r3l, 2.41 Å

PDB Description: potassium channel kcsa-fab complex in cs+

SCOP Domain Sequences for d1r3lb2:

Sequence; same for both SEQRES and ATOM records:

>d1r3lb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssswpsetvtcnvahpasstkvdkkivprd

Timeline for d1r3lb2:

• d1r3lb2 is new in SCOP 1.67
  
• d1r3lb2 appears in SCOP 1.69
  
• d1r3lb2 appears in the current release, SCOPe 2.08