Lineage for d1r3kc_ (1r3k C:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1696876Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
    oligomeric transmembrane alpha-helical proteins
  4. 1696877Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families) (S)
  5. 1696878Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 1696899Protein Potassium channel protein [56901] (2 species)
  7. 1696900Species Streptomyces coelicolor [TaxId:1902] [56902] (17 PDB entries)
    identical sequence to Streptomyces lividans, TaxId: 1916
    Uniprot Q54397 22-124
  8. 1696913Domain d1r3kc_: 1r3k C: [96937]
    Other proteins in same PDB: d1r3ka1, d1r3ka2, d1r3kb1, d1r3kb2
    complexed with dga, tl

Details for d1r3kc_

PDB Entry: 1r3k (more details), 2.8 Å

PDB Description: potassium channel kcsa-fab complex in low concentration of tl+
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d1r3kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r3kc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d1r3kc_:

Click to download the PDB-style file with coordinates for d1r3kc_.
(The format of our PDB-style files is described here.)

Timeline for d1r3kc_: