Lineage for d1r3ha1 (1r3h A:1181-1276)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1514397Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
    gamma, delta T-cell ligand
  7. 1514403Species Mouse (Mus musculus), t10 [TaxId:10090] [101512] (1 PDB entry)
  8. 1514404Domain d1r3ha1: 1r3h A:1181-1276 [96911]
    Other proteins in same PDB: d1r3ha2, d1r3hb_, d1r3hc2, d1r3hd_, d1r3he2, d1r3hf_, d1r3hg2, d1r3hh_

Details for d1r3ha1

PDB Entry: 1r3h (more details), 2.5 Å

PDB Description: Crystal Structure of T10
PDB Compounds: (A:) MHC h2-tl-t10-129

SCOPe Domain Sequences for d1r3ha1:

Sequence, based on SEQRES records: (download)

>d1r3ha1 b.1.1.2 (A:1181-1276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltqdvefvetrpagdgt
fqkwaavvvplgkvqsytchvdheglpepltlrwep

Sequence, based on observed residues (ATOM records): (download)

>d1r3ha1 b.1.1.2 (A:1181-1276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t10 [TaxId: 10090]}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqkdgeeltvefvetrpagdgtfq
kwaavvvplgkvqsytchvdheglpepltlrwep

SCOPe Domain Coordinates for d1r3ha1:

Click to download the PDB-style file with coordinates for d1r3ha1.
(The format of our PDB-style files is described here.)

Timeline for d1r3ha1: