Lineage for d1r2ya2 (1r2y A:2-134)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569023Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily)
    pseudobarrel; capped on both ends by alpha-helices
  4. 569024Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) (S)
  5. 569025Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins)
  6. 569026Protein DNA repair protein MutM (Fpg) [81621] (4 species)
  7. 569027Species Bacillus stearothermophilus [TaxId:1422] [81612] (7 PDB entries)
  8. 569033Domain d1r2ya2: 1r2y A:2-134 [96890]
    Other proteins in same PDB: d1r2ya1, d1r2ya3
    bound to 8-Oxoguanine (OxoG) containing DNA
    complexed with 8og, zn; mutant

Details for d1r2ya2

PDB Entry: 1r2y (more details), 2.34 Å

PDB Description: MutM (Fpg) bound to 8-oxoguanine (oxoG) containing DNA

SCOP Domain Sequences for d1r2ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ya2 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus}
pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf
lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya
keeadrrpplael

SCOP Domain Coordinates for d1r2ya2:

Click to download the PDB-style file with coordinates for d1r2ya2.
(The format of our PDB-style files is described here.)

Timeline for d1r2ya2: