Lineage for d1r2cm_ (1r2c M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027280Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 3027281Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. 3027282Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. 3027382Protein M (medium) subunit [81481] (4 species)
  7. 3027458Species Rhodopseudomonas viridis [TaxId:1079] [81478] (21 PDB entries)
  8. 3027468Domain d1r2cm_: 1r2c M: [96863]
    Other proteins in same PDB: d1r2cc_, d1r2ch1, d1r2ch2, d1r2cl_
    complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2

Details for d1r2cm_

PDB Entry: 1r2c (more details), 2.86 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)
PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d1r2cm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2cm_ f.26.1.1 (M:) M (medium) subunit {Rhodopseudomonas viridis [TaxId: 1079]}
adyqtiytqiqargphitvsgewgdndrvgkpfysywlgkigdaqigpiylgasgiaafa
fgstailiilfnmaaevhfdplqffrqffwlglyppkaqygmgipplhdggwwlmaglfm
tlslgswwirvysraralglgthiawnfaaaiffvlcigcihptlvgswsegvpfgiwph
idwltafsirygnfyycpwhgfsigfaygcgllfaahgatilavarfggdreieqitdrg
taveraalfwrwtigfnatiesvhrwgwffslmvmvsasvgilltgtfvdnwylwcvkhg
aapdypaylpatpdpaslpgapk

SCOPe Domain Coordinates for d1r2cm_:

Click to download the PDB-style file with coordinates for d1r2cm_.
(The format of our PDB-style files is described here.)

Timeline for d1r2cm_: