SCOPe 2.06: Domain d1r2cc_: 1r2c C:

Lineage for d1r2cc_ (1r2c C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.2: Photosynthetic reaction centre (cytochrome subunit) [48707] (2 proteins)
   consists of four heme-binding repeats
   automatically mapped to Pfam PF02276

6. Protein Photosynthetic reaction centre (cytochrome subunit) [48708] (2 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [48709] (21 PDB entries)

8. Domain d1r2cc_: 1r2c C: [96859]
   Other proteins in same PDB: d1r2ch1, d1r2ch2, d1r2cl_, d1r2cm_
   complexed with bcb, bpb, fe2, hem, lda, mq7, ns5, so4, uq2

Details for d1r2cc_

PDB Entry: 1r2c, 2.86 Å

PDB Description: photosynthetic reaction center blastochloris viridis (atcc)

PDB Compounds: (C:) Photosynthetic reaction center cytochrome C subunit precursor

SCOPe Domain Sequences for d1r2cc_:

Sequence; same for both SEQRES and ATOM records:

>d1r2cc_ a.138.1.2 (C:) Photosynthetic reaction centre (cytochrome subunit) {Rhodopseudomonas viridis [TaxId: 1079]}
cfepppatttqtgfrglsmgevlhpatvkakkerdaqyppalaavkaegppvsqvyknvk
vlgnlteaeflrtmtaitewvspqegctychdennlaseakypyvvarrmlemtraintn
wtqhvaqtgvtcytchrgtplppyvryleptlplnnretpthvervetrsgyvvrlakyt
aysalnydpftmflandkrqvrvvpqtalplvgvsrgkerrplsdayatfalmmsisdsl
gtnctfchnaqtfeswgkkstpqraiawwgirmvrdlnmnylaplnaslpasrlgrqgea
pqadcrtchqgvtkplfgasrlkdypelgpik

Timeline for d1r2cc_:

• d1r2cc_ first appeared in SCOP 1.67
  
• d1r2cc_ appears in SCOPe 2.05
  
• d1r2cc_ appears in SCOPe 2.07
  
• d1r2cc_ appears in the current release, SCOPe 2.08