Lineage for d1r2ba_ (1r2b A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 410976Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 410977Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 410978Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 410979Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 410980Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries)
  8. 410984Domain d1r2ba_: 1r2b A: [96857]

Details for d1r2ba_

PDB Entry: 1r2b (more details), 2.2 Å

PDB Description: crystal structure of the bcl6 btb domain complexed with a smrt co- repressor peptide

SCOP Domain Sequences for d1r2ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ba_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

SCOP Domain Coordinates for d1r2ba_:

Click to download the PDB-style file with coordinates for d1r2ba_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ba_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r2bb_