Lineage for d1r29a_ (1r29 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502928Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 502929Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 502930Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 502931Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 502932Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries)
  8. 502933Domain d1r29a_: 1r29 A: [96856]

Details for d1r29a_

PDB Entry: 1r29 (more details), 1.3 Å

PDB Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 1.3 angstrom

SCOP Domain Sequences for d1r29a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOP Domain Coordinates for d1r29a_:

Click to download the PDB-style file with coordinates for d1r29a_.
(The format of our PDB-style files is described here.)

Timeline for d1r29a_: