Lineage for d1r28b_ (1r28 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602160Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 602161Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 602162Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 602163Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 602164Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries)
  8. 602167Domain d1r28b_: 1r28 B: [96855]
    mutant

Details for d1r28b_

PDB Entry: 1r28 (more details), 2.2 Å

PDB Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 2.2 angstrom

SCOP Domain Sequences for d1r28b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r28b_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as

SCOP Domain Coordinates for d1r28b_:

Click to download the PDB-style file with coordinates for d1r28b_.
(The format of our PDB-style files is described here.)

Timeline for d1r28b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1r28a_