Lineage for d1r28b_ (1r28 B:)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.42: POZ domain [54694] (1 superfamily)
core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143Superfamily d.42.1: POZ domain [54695] (2 families) 
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries) 
Domain d1r28b_: 1r28 B: [96855]
mutant
Details for d1r28b_
PDB Entry: 1r28 (more details), 2.2 Å
PDB Description: crystal structure of the b-cell lymphoma 6 (bcl6) btb domain to 2.2 angstrom
SCOP Domain Sequences for d1r28b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r28b_ d.42.1.1 (B:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)}
sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk
rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik
as
SCOP Domain Coordinates for d1r28b_:
Click to download the PDB-style file with coordinates for d1r28b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r28b_:
- d1r28b_ is new in SCOP 1.67
- d1r28b_ appears in SCOP 1.69
- d1r28b_ appears in the current release, SCOPe 2.08
View in 3D
