Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102923] (3 PDB entries) |
Domain d1r28a_: 1r28 A: [96854] |
PDB Entry: 1r28 (more details), 2.2 Å
SCOP Domain Sequences for d1r28a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r28a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens)} sqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdqlk rnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkfik as
Timeline for d1r28a_: