Lineage for d1r1ob_ (1r1o B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395386Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 395387Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 395388Family c.42.1.1: Arginase-like amidino hydrolases [52769] (2 proteins)
  6. 395389Protein Arginase [52770] (3 species)
  7. 395428Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (19 PDB entries)
  8. 395451Domain d1r1ob_: 1r1o B: [96831]

Details for d1r1ob_

PDB Entry: 1r1o (more details), 2.8 Å

PDB Description: Amino Acid Sulfonamides as Transition-State Analogue Inhibitors of Arginase

SCOP Domain Sequences for d1r1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r1ob_ c.42.1.1 (B:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

SCOP Domain Coordinates for d1r1ob_:

Click to download the PDB-style file with coordinates for d1r1ob_.
(The format of our PDB-style files is described here.)

Timeline for d1r1ob_: