Lineage for d1r15h_ (1r15 H:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2117411Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2117455Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2117456Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2117457Species California sea hare (Aplysia californica) [TaxId:6500] [56632] (5 PDB entries)
  8. 2117473Domain d1r15h_: 1r15 H: [96793]
    complexed with n, nca

Details for d1r15h_

PDB Entry: 1r15 (more details), 2.4 Å

PDB Description: Aplysia ADP ribosyl cyclase with bound nicotinamide and R5P
PDB Compounds: (H:) ADP-ribosyl cyclase

SCOPe Domain Sequences for d1r15h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r15h_ c.23.14.3 (H:) ADP ribosyl cyclase {California sea hare (Aplysia californica) [TaxId: 6500]}
ivptrelenvflgrckdyeitryldilprvrsdcsalwkdffkafsfknpcdldlgsykd
fftsaqqqlpknkvmfwsgvydeahdyantgrkyitledtlpgymlnslvwcgqranpgf
nekvcpdfktcpvqaresfwgmasssyahsaegevtymvdgsnpkvpayrpdsffgkyel
pnltnkvtrvkvivlhrlgekiiekcgagslldleklvkakhfafdcvenpravlfllcs
dnpnarecrla

SCOPe Domain Coordinates for d1r15h_:

Click to download the PDB-style file with coordinates for d1r15h_.
(The format of our PDB-style files is described here.)

Timeline for d1r15h_: