SCOP 1.71: Domain d1r13a1: 1r13 A:110-228

Lineage for d1r13a1 (1r13 A:110-228)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
   Pfam 00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Rat (Rattus norvegicus), SP-A [TaxId:10116] [103352] (2 PDB entries)

8. Domain d1r13a1: 1r13 A:110-228 [96782]
   Other proteins in same PDB: d1r13a2
   complexed with ca, mes, so4; mutant

Details for d1r13a1

PDB Entry: 1r13, 2.1 Å

PDB Description: carbohydrate recognition and neck domains of surfactant protein a (sp- a)

SCOP Domain Sequences for d1r13a1:

Sequence; same for both SEQRES and ATOM records:

>d1r13a1 d.169.1.1 (A:110-228) Surfactant protein, lectin domain {Rat (Rattus norvegicus), SP-A}
smlsvgdkvfstngqsvnfdtikemctraggniavprtpeeneaiasiakkynnyvylgm
iedqtpgdfhyldgasvsytnwypgeprgqgkekcvemytdgtwndrgclqyrlavcef

Timeline for d1r13a1:

• d1r13a1 first appeared in SCOP 1.67
  
• d1r13a1 appears in SCOP 1.69
  
• d1r13a1 appears in SCOP 1.73
  
• d1r13a1 appears in the current release, SCOPe 2.08