Class g: Small proteins [56992] (72 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) |
Family g.39.1.2: Nuclear receptor [57721] (11 proteins) duplication: two zinc-binding motifs |
Protein Ultraspiracle protein [103603] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103604] (1 PDB entry) |
Domain d1r0oa_: 1r0o A: [96732] Other proteins in same PDB: d1r0ob_ complexed with zn |
PDB Entry: 1r0o (more details), 2.24 Å
SCOP Domain Sequences for d1r0oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0oa_ g.39.1.2 (A:) Ultraspiracle protein {Fruit fly (Drosophila melanogaster)} hlcsicgdrasgkhygvyscegckgffkrtvrkdltyacrenrnciidkrqrnrcqycry qkcltcgmkreavqee
Timeline for d1r0oa_: