Lineage for d1r0oa_ (1r0o A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 429921Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 429922Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families) (S)
  5. 429936Family g.39.1.2: Nuclear receptor [57721] (11 proteins)
    duplication: two zinc-binding motifs
  6. 429994Protein Ultraspiracle protein [103603] (1 species)
  7. 429995Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [103604] (1 PDB entry)
  8. 429996Domain d1r0oa_: 1r0o A: [96732]
    Other proteins in same PDB: d1r0ob_
    complexed with zn

Details for d1r0oa_

PDB Entry: 1r0o (more details), 2.24 Å

PDB Description: Crystal Structure of the Heterodimeric Ecdysone Receptor DNA-binding Complex

SCOP Domain Sequences for d1r0oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0oa_ g.39.1.2 (A:) Ultraspiracle protein {Fruit fly (Drosophila melanogaster)}
hlcsicgdrasgkhygvyscegckgffkrtvrkdltyacrenrnciidkrqrnrcqycry
qkcltcgmkreavqee

SCOP Domain Coordinates for d1r0oa_:

Click to download the PDB-style file with coordinates for d1r0oa_.
(The format of our PDB-style files is described here.)

Timeline for d1r0oa_: