Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.2: Nuclear receptor [57721] (13 proteins) duplication: two zinc-binding motifs |
Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57723] (5 PDB entries) |
Domain d1r0na1: 1r0n A:99-172 [96730] Other proteins in same PDB: d1r0na2, d1r0nb_ protein/DNA complex; complexed with zn |
PDB Entry: 1r0n (more details), 2.6 Å
SCOPe Domain Sequences for d1r0na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0na1 g.39.1.2 (A:99-172) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} hicaicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycry qkclamgmkreavq
Timeline for d1r0na1: