SCOPe 2.01: Domain d1qzya1: 1qzy A:375-448

Lineage for d1qzya1 (1qzy A:375-448)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.25: Methionine aminopeptidase, insert domain [46887] (1 protein)
   circularly permuted version of the "winged helix" fold

6. Protein Methionine aminopeptidase, insert domain [46888] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46890] (18 PDB entries)
   Uniprot P50579 110-478

8. Domain d1qzya1: 1qzy A:375-448 [96717]
   Other proteins in same PDB: d1qzya2
   complexed with co, tbu, tde

Details for d1qzya1

PDB Entry: 1qzy, 1.6 Å

PDB Description: Human Methionine Aminopeptidase in complex with bengamide inhibitor LAF153 and cobalt

PDB Compounds: (A:) Methionine aminopeptidase 2

SCOPe Domain Sequences for d1qzya1:

Sequence; same for both SEQRES and ATOM records:

>d1qzya1 a.4.5.25 (A:375-448) Methionine aminopeptidase, insert domain {Human (Homo sapiens) [TaxId: 9606]}
hddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskylmalkn
lcdlgivdpypplc

Timeline for d1qzya1:

• d1qzya1 first appeared in SCOP 1.67
  
• d1qzya1 appears in SCOP 1.75
  
• d1qzya1 appears in SCOPe 2.02
  
• d1qzya1 appears in the current release, SCOPe 2.08